DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppid

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_988984.1 Gene:ppid / 394581 XenbaseID:XB-GENE-855598 Length:370 Species:Xenopus tropicalis


Alignment Length:147 Identity:62/147 - (42%)
Similarity:86/147 - (58%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASD-----------YYSGCVFIRNIKGFIVQTGDPTN-TGK 61
            ||.:.:|||.|..||..|||.||...:           ::.||.|.|.||.|::|.||.:| .|.
 Frog    29 VGRIVLELFADVVPKTAENFRALSTGEKGIGQSTGKPLHFKGCPFHRIIKKFMIQCGDFSNQNGT 93

  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFD 126
            .|:||:|:||:|| ....||...|::||||.|||.|.||||||.....:||.|:.:||:|:.|:.
 Frog    94 GGESIYGEKFEDE-NFHYKHDKEGLLSMANAGPNTNGSQFFITTVPTAHLDGKHVVFGQVLKGYG 157

  Fly   127 ALDELEKLPVNPKNYRP 143
            .:..||.:.|  |:.:|
 Frog   158 IVKMLENVEV--KDEKP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 62/147 (42%)
ppidNP_988984.1 cyclophilin_ABH_like 16..182 CDD:238907 62/147 (42%)
3a0801s09 192..>362 CDD:273380
TPR repeat 223..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..335 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.