DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cwc27

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_957397.1 Gene:cwc27 / 394078 ZFINID:ZDB-GENE-040426-1118 Length:470 Species:Danio rerio


Alignment Length:148 Identity:64/148 - (43%)
Similarity:85/148 - (57%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|.|..||:.|||:....||||.||:.||...||.|.:|.|.:..||||.||||.||..|:||:
Zfish    15 VLLKTSAGDIDIELWSKETPKACRNFVQLCMEGYYDGTIFHRMVPEFIVQGGDPTGTGTGGESIY 79

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDG-------- 124
            |:.|.|||...::...||:|:|||.||:.|.||||.|......|:.|:|:||:|...        
Zfish    80 GRPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRL 144

  Fly   125 FDALDELEKLPVNPKNYR 142
            .|...:.::.|:||...|
Zfish   145 ADVACDGDERPLNPHKIR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/148 (43%)
cwc27NP_957397.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 64/148 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..377
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.