DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CG8336

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:189 Identity:64/189 - (33%)
Similarity:88/189 - (46%) Gaps:50/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVGDLKIELFCDACPKACENFLALCASD----------YYSGCVFIRNIKGFIVQTGDPT-NTGK 61
            |.|.:.|||..|..||..|||.|||..:          :|.|..|.:..:.|:||:||.. |.|.
  Fly    27 DAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGS 91

  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNG-PNANASQFFITYAAQPNLDLKYTLFGRVIDGF 125
            :|:||:|..||||..| :.|.:.|:|||||.| ||:|.|||||:.|...||:....:.|||:.|.
  Fly    92 SGESIYGPVFDDENFE-LSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGL 155

  Fly   126 DALDELE-------------------------------------KLPVNPKNYRPHVDK 147
            ..:.|:|                                     |||..|:::...:||
  Fly   156 GIVAEMEQNCTDEGDPTAPIVIRDCGEIAHNEDWGIECNDETTDKLPAYPQDWPRKLDK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/189 (34%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 58/154 (38%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447196
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.