DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CG2852

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:150 Identity:55/150 - (36%)
Similarity:82/150 - (54%) Gaps:13/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLKIELFCDACPKACENFLALC---ASDYYSGCVFIRNIKGFIVQTGDPT-NTGKNGQSIWGQK 70
            |.::|.||....||..|||..|.   ..:.|.|..|.|.||.|::|.||.| ..|..|:||:|::
  Fly    43 GRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGER 107

  Fly    71 FDDE-FKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELEKL 134
            |:|| ||  :||...|.:||||.|.:.|.||||||......||.::.:||:::.|.:.:.::|..
  Fly   108 FEDENFK--LKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENS 170

  Fly   135 PVNPKNYRPHVDKKINGVTI 154
            ..:.:      |:.:..|.|
  Fly   171 ATDAR------DRPVKDVVI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 54/148 (36%)
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 54/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447207
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.