DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cyp33

DIOPT Version :10

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:130 Identity:56/130 - (43%)
Similarity:74/130 - (56%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNIKGFIVQTGDPT-NTGKNGQSIWG 68
            |.|.:.:.|..|..||..|||..||..:.   |.||.|.|.|..|:.|.||.| |.|..|:||:|
  Fly   151 DAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYG 215

  Fly    69 QKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELEK 133
            :||:|| ...:||...|.:||||:|.|.|.|||||.......||.|:.:||.||.|.:.:.::|:
  Fly   216 KKFNDE-NFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMER 279

  Fly   134  133
              Fly   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 56/130 (43%)
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 56/130 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.