DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CG7747

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:158 Identity:80/158 - (50%)
Similarity:113/158 - (71%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|:|::|.|.:|||||..|:||:||:..||:.||:..:|.|:|:.||||.||||.:|..|:|||
  Fly   282 VRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIW 346

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            |:||:||||..:.||.||::||||:|||.|.|||||||.:..:||.|:|:||:::.|.|.|.::|
  Fly   347 GKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKME 411

  Fly   133 KLPVNPKNYRPHVDKKINGVTIHANPLA 160
            .:.|:.|: ||..|..|....:..||.|
  Fly   412 NIEVDNKD-RPIEDIIIESSQVFVNPFA 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 77/150 (51%)
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 80/158 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447176
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45625
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.