DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Cwc27

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_017446439.1 Gene:Cwc27 / 361887 RGDID:1310697 Length:471 Species:Rattus norvegicus


Alignment Length:169 Identity:68/169 - (40%)
Similarity:92/169 - (54%) Gaps:26/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|.|..||:.|||:....||||.||:.||...||...:|.|.:.|||||.||||.||..|:|::
  Rat    15 VLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGTGGESVY 79

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRV----------- 121
            |..|.|||...::...||:|:|||.||:.|.||||.|......|:.|:|:||:|           
  Rat    80 GAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRL 144

  Fly   122 --IDGFDALDELEKLPVNPKNYRPHVDKKINGVTIHANP 158
              :|    :|:.|:    |:|  ||   :|....:..||
  Rat   145 TEVD----IDDEER----PRN--PH---RIKSCEVLFNP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 66/163 (40%)
Cwc27XP_017446439.1 cyclophilin_CeCYP16-like 8..177 CDD:238906 68/169 (40%)
TMEM119 <308..>359 CDD:292352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.