DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppil2

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001017383.1 Gene:Ppil2 / 360746 RGDID:1309484 Length:521 Species:Rattus norvegicus


Alignment Length:156 Identity:79/156 - (50%)
Similarity:106/156 - (67%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|||:.|||.:||.||..||.||||:.||...||.|.:|.|:|:.|::|.||||.||..|:|.|
  Rat   282 VRLHTNKGDLNLELHCDLTPKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYW 346

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            |:.|.|||:..:.||.||::||||:|||.|.||||||:.:...||.|:|:||||:.|||.|..:|
  Rat   347 GKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTAME 411

  Fly   133 KLPVNPKNYRPHVDKKINGVTIHANP 158
            .:..:||..||..:.:|...|:..:|
  Rat   412 NVESDPKTDRPKEEVRICTTTVFVDP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 77/150 (51%)
Ppil2NP_001017383.1 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 79/156 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.