DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CG17266

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:143 Identity:58/143 - (40%)
Similarity:77/143 - (53%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TDVGDLKIELFCDACPKACENFLALCASDY--------YSGCVFIRNIKGFIVQTGD-PTNTGKN 62
            |::|.:..|||.|..|:..|||...|..:|        |.|..|.|.||.|::|.|| ....|..
  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92

  Fly    63 GQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDA 127
            ..||:|..|.|| ..|:||...|::||||:|...|..|||||.|....||.|:.:||||:||...
  Fly    93 VTSIYGNTFGDE-NFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLI 156

  Fly   128 LDELEKLPVNPKN 140
            :.::|.:|..|.|
  Fly   157 MRKIENVPTGPNN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 58/143 (41%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 58/143 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447213
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.