DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppiaa

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_997923.1 Gene:ppiaa / 336612 ZFINID:ZDB-GENE-030131-8556 Length:164 Species:Danio rerio


Alignment Length:128 Identity:60/128 - (46%)
Similarity:76/128 - (59%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASD--Y-YSGCVFIRNIKGFIVQTGDPTN-TGKNGQSIWGQ 69
            ||.:.:||..|..|:..|||..||...  | |.|..|.|.|.||:.|.||.|| .|..|:||:|.
Zfish    17 VGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGN 81

  Fly    70 KFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            ||.|| ...:|||..|.:||||.|||.|.|||||..|....||.|:.:||:|::|.|.:.::|
Zfish    82 KFADE-NFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDGKHVVFGQVVEGLDVIKKVE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 60/128 (47%)
ppiaaNP_997923.1 cyclophilin_ABH_like 4..162 CDD:238907 60/128 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.