DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ninaA

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:143 Identity:51/143 - (35%)
Similarity:70/143 - (48%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCA----SDYYSGCVFIRNIKGFIVQTGDPTN-TGKNGQSIWG 68
            ||.:...||....||...||..:|.    ...|.|..|.|.:..|:||.||..| .|....||:|
  Fly    40 VGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYG 104

  Fly    69 QKFDDEFKE-TIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            ..|.||.|. .::|...|.:.|||.||:.|..||::|......||.|:|:||:|::|.|.:..:|
  Fly   105 DYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169

  Fly   133 KL-------PVNP 138
            .:       ||.|
  Fly   170 DVKTDTDDFPVEP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 51/143 (36%)
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 51/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.