DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppil3

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:160 Identity:116/160 - (72%)
Similarity:134/160 - (83%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQS 65
            |||||||||||:|||:||:..||.||||||||||:||:||||.||||||:|||||||.||:.|.|
  Rat     1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSS 65

  Fly    66 IWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDE 130
            |||:||:||:.|.:||..||:|||||||||.|.|||||||..||:||:|||:||:||||.:.|||
  Rat    66 IWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDE 130

  Fly   131 LEKLPVNPKNYRPHVDKKINGVTIHANPLA 160
            |||||||.|.|||..|..|..:||||||.|
  Rat   131 LEKLPVNEKTYRPLNDVHIKDITIHANPFA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 109/152 (72%)
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 109/152 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I2229
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41717
Inparanoid 1 1.050 254 1.000 Inparanoid score I3113
OMA 1 1.010 - - QHG54802
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto96726
orthoMCL 1 0.900 - - OOG6_102733
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3671
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.