DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cyp8

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_594502.2 Gene:cyp8 / 2541969 PomBaseID:SPAC21E11.05c Length:516 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:73/152 - (48%)
Similarity:96/152 - (63%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIWGQKF 71
            |:.|::.|||..|..|.|..||:.|....||...:|.|||..|::|.|||:.||:.||||||:.|
pombe   282 TNHGEINIELHTDYAPHAVYNFVQLAKQGYYRNTIFHRNIARFMIQGGDPSGTGRGGQSIWGKPF 346

  Fly    72 DDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELEKLPV 136
            .|||...:||.|||::||||.|.|.|.|||||.|....:||.|:|:||||:.|.:.||.|||:|.
pombe   347 KDEFCNPLKHDDRGIISMANRGKNTNGSQFFILYGPAKHLDNKHTIFGRVVGGLNVLDALEKVPT 411

  Fly   137 NPKNYRPHVDKKINGVTIHANP 158
            | .|..|.:..|:..:.|..:|
pombe   412 N-SNDHPKLPIKLEDIIIFVDP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 71/146 (49%)
cyp8NP_594502.2 RING 45..108 CDD:302633
cyclophilin_RING 277..433 CDD:238904 73/152 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R964
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.