DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppig

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001074555.1 Gene:Ppig / 228005 MGIID:2445173 Length:752 Species:Mus musculus


Alignment Length:152 Identity:58/152 - (38%)
Similarity:84/152 - (55%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLKIELFCDACPKACENFLALCASD-----------YYSGCVFIRNIKGFIVQTGD-PTNTGKN 62
            |.:..|||.|.|||.||||..||..:           :|..|:|.|.:|.|:||.|| ....|:.
Mouse    22 GRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRG 86

  Fly    63 GQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDA 127
            |:||:|..|:|| ...:||....::||||.|.:.|.||||||....|:||..:.:||:||.|.:.
Mouse    87 GESIYGGFFEDE-SFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEV 150

  Fly   128 LDELEKLPVNPKNYRPHVDKKI 149
            :.|:|....:..: :|..:.:|
Mouse   151 VREIENQKTDAAS-KPFAEVRI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 58/152 (38%)
PpigNP_001074555.1 cyclophilin 8..175 CDD:412213 58/152 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..752
PTZ00121 <401..750 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.