DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cyn-12

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_501118.1 Gene:cyn-12 / 191627 WormBaseID:WBGene00000888 Length:169 Species:Caenorhabditis elegans


Alignment Length:148 Identity:67/148 - (45%)
Similarity:95/148 - (64%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|.|.:|.:.:||:.:..|:.|:||..|...:||:|.:|.|.|..|::|.||||.||:.|.||:
 Worm    12 VILDTTMGKIALELYWNHAPRTCQNFSQLAKRNYYNGTIFHRIIADFMIQGGDPTGTGRGGASIY 76

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            |.||.||..|.:|||..|::||||.|||.|.||||||.|...:||.|:|:||||..|...:..:.
 Worm    77 GDKFSDEIDERLKHTGAGILSMANAGPNTNGSQFFITLAPTQHLDGKHTIFGRVAAGMKVIANMG 141

  Fly   133 KLPVNPKNY-RPHVDKKI 149
            :  |:..|: ||.::.:|
 Worm   142 R--VDTDNHDRPKIEIRI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 67/148 (45%)
cyn-12NP_501118.1 cyclophilin_SpCYP2_like 13..159 CDD:238903 66/147 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.