DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppic

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_032934.1 Gene:Ppic / 19038 MGIID:97751 Length:212 Species:Mus musculus


Alignment Length:144 Identity:64/144 - (44%)
Similarity:82/144 - (56%) Gaps:8/144 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNIKGFIVQTGDPT-NTGKNGQSIWG 68
            |||.:.|.||.:..||..|||:||...:.   |.|.:|.|.||.|::|.||.| ..|..|.||:|
Mouse    50 DVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYG 114

  Fly    69 QKFDDE-FKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            :.|.|| ||  :||...|.|||||.||:.|.||||||......||.|:.:||:|:||...:..:|
Mouse   115 ETFPDENFK--LKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIE 177

  Fly   133 KLPVNPKNYRPHVD 146
             |.....:.||..|
Mouse   178 -LQATDGHDRPLTD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/144 (44%)
PpicNP_032934.1 cyclophilin_ABH_like 38..197 CDD:238907 64/144 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.