DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cyn-8

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_509507.1 Gene:cyn-8 / 181136 WormBaseID:WBGene00000884 Length:447 Species:Caenorhabditis elegans


Alignment Length:155 Identity:61/155 - (39%)
Similarity:82/155 - (52%) Gaps:17/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLKIELFCDACPKACENFLALCASDY---------YSGCVFIRNIKGFIVQTGDPTN-TGKNGQ 64
            |.:...|:...||:..|||.|.|..:.         |.|.||.|.||||::|.||.|: .|..|.
 Worm    23 GRIVFSLWNHCCPRTVENFRAFCTGELGKMNGHYASYQGSVFHRVIKGFMIQGGDITHGNGTGGY 87

  Fly    65 SIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALD 129
            ||:|:.|||| ...:||....::||||.||:.|.||||||....|:||.|:.:||.||.|.:.:.
 Worm    88 SIYGRTFDDE-NLALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKHCVFGEVIKGVEVVK 151

  Fly   130 ELEKLPVNPKNYRPHVDKKINGVTI 154
            .:|.|...      :.||.:..|.|
 Worm   152 AIENLETG------NEDKPVCKVEI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 60/153 (39%)
cyn-8NP_509507.1 cyclophilin 10..174 CDD:412213 61/155 (39%)
ATP-synt_Fo_b <324..391 CDD:349951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.