DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cyn-4

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:156 Identity:71/156 - (45%)
Similarity:91/156 - (58%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|.|:.|.|.:|||....|||||||:..|::.||:...|.|.||.|::|.||||.||..|:|||
 Worm   282 VRLVTNFGPLNLELFAPKVPKACENFITHCSNGYYNNTKFHRLIKNFMLQGGDPTGTGHGGESIW 346

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            .:.|.|||.....|..||::||||.|.|.|.||||||:.....||.|:|:|||::.|.|.|..:|
 Worm   347 DKPFSDEFISGFSHDARGVLSMANKGSNTNGSQFFITFRPCKYLDRKHTIFGRLVGGQDTLTTIE 411

  Fly   133 KLPVNPKNYRPHVDKKINGVTIHANP 158
            ||........|.|...|....:..:|
 Worm   412 KLETEEGTDVPMVSVVIMRAEVFVDP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 70/150 (47%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 71/156 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.