DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cyn-10

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001021890.1 Gene:cyn-10 / 174132 WormBaseID:WBGene00000886 Length:161 Species:Caenorhabditis elegans


Alignment Length:160 Identity:111/160 - (69%)
Similarity:132/160 - (82%) Gaps:1/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQS 65
            |||||||..||:||||:.|..||||||||||||||||:||:|.||||.|:|||||||::||.|:|
 Worm     1 MSVTLHTTSGDIKIELYVDDAPKACENFLALCASDYYNGCIFHRNIKDFMVQTGDPTHSGKGGES 65

  Fly    66 IWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDE 130
            |||..|:|||...:||..||.||||||||::|.||||||||.|.:||:||||||:||||||.|:|
 Worm    66 IWGGPFEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAKQAHLDMKYTLFGKVIDGFDTLEE 130

  Fly   131 LEKLPVNPKNYRPHVDKKINGVTIHANPLA 160
            :|.:.|:.| |||.|.:||..|||||||:|
 Worm   131 IETIKVDNK-YRPLVQQKIQNVTIHANPMA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 104/152 (68%)
cyn-10NP_001021890.1 Cyclophilin_PPIL3_like 1..153 CDD:238909 104/152 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I1536
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41717
Inparanoid 1 1.050 235 1.000 Inparanoid score I2155
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54802
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto17746
orthoMCL 1 0.900 - - OOG6_102733
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R964
SonicParanoid 1 1.000 - - X3671
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1414.010

Return to query results.
Submit another query.