DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppic

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:159 Identity:64/159 - (40%)
Similarity:88/159 - (55%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TDVGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNIKGFIVQTGDPTN-TGKNGQSIW 67
            ||.|.:.|.||....||..:||:||...:.   |.|..|.|.||.|::|.||.|| .|..|:||:
 Frog    43 TDAGRIVIGLFGKVVPKTVKNFVALATGEKGYGYKGSRFHRVIKDFMIQGGDVTNGDGTGGKSIY 107

  Fly    68 GQKFDDE-FKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDEL 131
            |:.|.|| ||  :||...|.|||||.||:.|.|||||:......|:.|:.:||:|::|...:..:
 Frog   108 GETFPDENFK--LKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKHVVFGKVLEGMAVVHLI 170

  Fly   132 EKLPVNPKNYRPHVDKKI--NGVTIHANP 158
            |....|.:: :|..|..|  :||.....|
 Frog   171 ELQQTNERD-QPLKDCVIVNSGVVTVKEP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 63/153 (41%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 61/150 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.