DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Nktr

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:165 Identity:64/165 - (38%)
Similarity:91/165 - (55%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASD-----------YYSGCVFIRNIKGFIVQTGD-PTNTGK 61
            ||.:..:||.|.|||.|:|||.||:.:           .|.|..|.|.:|.|::|.|| ....||
  Rat    79 VGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGK 143

  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFD 126
            .|:||:|..|.|| ...:||....::||||.|.:.|.||||||....|:||..:.:||.||.||:
  Rat   144 GGESIYGGYFKDE-NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFE 207

  Fly   127 ALDELEKLPVNPKNYRPHVDKKINGVTIHANPLAT 161
            .::::|.|..:..: ||:.|.::    |....|||
  Rat   208 VIEQIENLKTDAAS-RPYADVRV----IDCGVLAT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 60/156 (38%)
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 61/159 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.