DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and cwc27

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_002934241.3 Gene:cwc27 / 100145114 XenbaseID:XB-GENE-942796 Length:474 Species:Xenopus tropicalis


Alignment Length:166 Identity:63/166 - (37%)
Similarity:88/166 - (53%) Gaps:20/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|.|..|::.|||:....|:||.||:.||...||...:|.|.:..||:|.||||.||..|:|::
 Frog    15 VLLKTTAGEIDIELWSKEAPRACRNFVQLCLEGYYDNTIFHRVVPDFIIQGGDPTGTGTGGESVY 79

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            |:.|.|||...::...||:|:|||.||:.|.||||.|......|:.|:|:.|:|..  |.:..:.
 Frog    80 GKPFRDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTILGKVTG--DTIYNIL 142

  Fly   133 KL----------PVNPKNYRPHVDKKINGVTIHANP 158
            :|          ||||        .||....:..||
 Frog   143 RLAEVDIGEDERPVNP--------HKIKTTEVLFNP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 61/160 (38%)
cwc27XP_002934241.3 cyclophilin_CeCYP16-like 8..178 CDD:238906 63/166 (38%)
PTZ00121 <283..>471 CDD:173412
CWC27_CTD 378..430 CDD:412084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.