DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppwd1

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001092228.1 Gene:ppwd1 / 100000660 ZFINID:ZDB-GENE-070615-16 Length:622 Species:Danio rerio


Alignment Length:153 Identity:72/153 - (47%)
Similarity:97/153 - (63%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSI 66
            |..:||.:||:.|:||...|||..|||.....:.||:|.:|.|.||||::||||||.||..|:||
Zfish   469 SAIIHTTMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHIFHRVIKGFMIQTGDPTGTGMGGESI 533

  Fly    67 WGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDEL 131
            ||.:|:|||..|::|.....:||||.||..|.||||||....|.||.|:|:|||...|.:.:..:
Zfish   534 WGGEFEDEFHSTLRHDRPYTLSMANAGPGTNGSQFFITVVPTPWLDNKHTVFGRTSKGMEVVQRI 598

  Fly   132 EKLPVNPKNYRPHVDKKINGVTI 154
            ..:.||||..:|:.|..|..:|:
Zfish   599 SNIKVNPKTDKPYEDISIINITV 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 71/151 (47%)
ppwd1NP_001092228.1 WD40 64..294 CDD:295369
WD40 <64..287 CDD:225201
WD40 repeat 69..107 CDD:293791
WD40 repeat 112..161 CDD:293791
WD40 repeat 167..195 CDD:293791
WD40 repeat 202..253 CDD:293791
WD40 repeat 259..302 CDD:293791
cyclophilin_WD40 471..619 CDD:238908 70/147 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.