DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and CYP96A4

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:457 Identity:105/457 - (22%)
Similarity:176/457 - (38%) Gaps:88/457 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 VGGLIGHPDLLFVFDGDEIRNIFKKEEAMPHRPSMPSLRHYKGDLRR---DFFGDVAGLIGVHGP 208
            :|..:...|:|...|...|:.|.          |...:.:.||....   :|.||  |:..|...
plant    71 IGPWLSGTDILLTVDPVNIQYIL----------SSNFVNYPKGKKFNKIFEFLGD--GIFNVDSG 123

  Fly   209 KWEAFR---------QEVQHILLQPQTAK--KYIPPLNDIASEFMGRIELMRDEKDELPANFLHE 262
            .||..|         |:.|...:....:|  :.:.|:.|.|.|....::|     .:|...||.:
plant   124 LWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQGLVPILDNAVEKHILVDL-----QDLFQRFLFD 183

  Fly   263 LYKWALESVGRVSLDTRLGCL----SPEGSEEAQQIIEAINTFFWAVPE-----LELRMPLWRIY 318
            .....:......||...:..:    :.:|..:|.........|.|::..     :|.:|.     
plant   184 TSSTLMAGYDPKSLSVEMPKVEFADAMDGVADAMFYRHLKPAFLWSIQSWIGVGIEKKMR----- 243

  Fly   319 PTKAYRSFVKALDQFTAICMKNIGKTMD-KADADEARGL--SKSEA----------DISIVERIV 370
                     :.||.|..:    :||.:. |.:..:..|:  ||.||          |.:..:.: 
plant   244 ---------RGLDVFDQM----LGKIISAKREEIKNHGIHDSKGEAMDVLTYYMTIDTTKYKHL- 294

  Fly   371 RKTGNRKLAAILALDLFLVGVDTTSVAASSTIYQLAKNPDKQKKLFDELQKVFPHRE-ADINQNV 434
             |..|.|......|.|.:...||||.|.:...:.|:|||:...|:..|:.|..|..: ||     
plant   295 -KPSNDKFIRDTILGLVIAARDTTSSALTWFFWLLSKNPEAMTKIRQEINKKMPKFDPAD----- 353

  Fly   435 LEQMPYLRACVKETLRMRPVVIANGRS-LQSDAVINGYHVPKGTHVIFP-HLVVSNDPAYFPEPK 497
            |:::.||...|.||||:.|.|..|.:| .:.|.:.:|:.|.|...|:.| :.:......:..:.:
plant   354 LDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDVLPSGHKVDKNWRVVIPIYSLGRMKSVWGDDAE 418

  Fly   498 RFLPERWLKQSTDAAGCPHANQKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKYKVSYN 562
            .|.||||:..|    |.......   :..|.|..|.|.|:|:|...:::.|:..:|.|.|.:...
plant   419 DFRPERWISDS----GMLRQESS---YKFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRNYDIKVV 476

  Fly   563 SG 564
            .|
plant   477 EG 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 105/457 (23%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 105/457 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.