DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and CYP707A1

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_974574.1 Gene:CYP707A1 / 827663 AraportID:AT4G19230 Length:484 Species:Arabidopsis thaliana


Alignment Length:495 Identity:95/495 - (19%)
Similarity:165/495 - (33%) Gaps:149/495 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RTTASSLPAETTSSPAAAVRPYSEVPGPYPLPLIGNSWRFAPLIGTYKISDLDKVMNELHVN--Y 141
            :|.....|....|||.||           ...|:..|..|.|.....|...|.|.....|..  :
plant    73 KTHVLGCPCVMISSPEAA-----------KFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYH 126

  Fly   142 GKMAKVGGLIGHPDLLFVFDGDEIRNIFKKEEAMPHRPSMPSLRHYKGDL------RRDFFGDVA 200
            .|:.|:        :|..|..:.|||:....|::    :..|||.::|.:      .:.:..:||
plant   127 AKLRKL--------VLRAFMPESIRNMVPDIESI----AQDSLRSWEGTMINTYQEMKTYTFNVA 179

  Fly   201 GLIGVHGPKWEAFRQEVQ--HILLQPQTAKKY-IPPLNDIASEFMGRIELMRDEKDELPANFLHE 262
             |:.:.|.....:|::::  :.:|:    |.| ..|:|                   ||....|:
plant   180 -LLSIFGKDEVLYREDLKRCYYILE----KGYNSMPVN-------------------LPGTLFHK 220

  Fly   263 LYKWALESVGRVSLDTRLGCLSPEGSEEAQQIIEAINTFFWAVPELELRMPLWRIYPTKAYRSFV 327
            ..|      .|..|...|..:..|..:......:.:.:|.....||                   
plant   221 SMK------ARKELSQILARILSERRQNGSSHNDLLGSFMGDKEEL------------------- 260

  Fly   328 KALDQFTAICMKNIGKTMDKADADEARGLSKSEADISIVERIVRKTGNRKLAAILALDLFLVGVD 392
                                             .|..|.:.|:              .:.....|
plant   261 ---------------------------------TDEQIADNII--------------GVIFAARD 278

  Fly   393 TTSVAASSTIYQLAKNPDKQKKLFDELQKVFPHRE--ADINQNVLEQMPYLRACVKETLRMRPVV 455
            ||:...|..:..||:||:..:.:.:|...:...:|  ..:.....::||.....::||||:..::
plant   279 TTASVMSWILKYLAENPNVLEAVTEEQMAIRKDKEEGESLTWGDTKKMPLTSRVIQETLRVASIL 343

  Fly   456 IANGRSLQSDAVINGYHVPKGTHV--IFPHLVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHAN 518
            ....|....|....||.:|||..|  :|.::..|.|  .|..|.:|.|.|:     :.|..|:  
plant   344 SFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSAD--IFSNPGKFDPSRF-----EVAPKPN-- 399

  Fly   519 QKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKYK 558
                  ..:|||.|...|.|...|::|:..::..:..||:
plant   400 ------TFMPFGNGTHSCPGNELAKLEMSIMIHHLTTKYR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 88/470 (19%)
CYP707A1NP_974574.1 PLN02196 1..464 CDD:177847 95/495 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.