DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and CYP718

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_181813.1 Gene:CYP718 / 818885 AraportID:AT2G42850 Length:485 Species:Arabidopsis thaliana


Alignment Length:515 Identity:115/515 - (22%)
Similarity:192/515 - (37%) Gaps:124/515 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VPGPYPLPLIGNSWRFAPLIGTYKISDLDKV----MNELHVNYGKMAKVGGLIGHPDLLFVFDGD 163
            :||...||.||.:..|      ||....::|    :|...:.:|.:.|. .::|.|.:  |.:|.
plant    46 LPGEMGLPWIGETMDF------YKAQKSNRVFEDFVNPRIIKHGNIFKT-RIMGSPTI--VVNGA 101

  Fly   164 EIRNIFKKEEAMPHRPSMPS----------LRHYKGDLRRDFFGDVAGLIGVHGPKWEAFRQEVQ 218
            |...:....|......|.||          :...:|:..|...|.||..:...|           
plant   102 EANRLILSNEFSLVVSSWPSSSVQLMGMNCIMAKQGEKHRVLRGIVANSLSYIG----------- 155

  Fly   219 HILLQPQTAKKYIPPLNDIA-----SEFMGR--IELMRDEKDELPANFLHE-LYKWALESVGRVS 275
                    .:..||.|.|..     :|:.|:  |.|.|..| .|....:.| ||          .
plant   156 --------LESLIPKLCDTVKFHHETEWRGKEEISLYRSAK-VLTFTVVFECLY----------G 201

  Fly   276 LDTRLGCLSPEGSEEAQQIIEAINTFFWAVPELELRMPLWRIYPTKAYRSFVKA---LDQFTAIC 337
            :...:|.|     |..::::|.:    :|:| :|        :|...:....||   ::.|.   
plant   202 IKVEIGML-----EVFERVLEGV----FALP-VE--------FPCSKFARAKKARLEIETFL--- 245

  Fly   338 MKNIGKTMDKADADEARGLSKSEADI--SIVERIVRKTGNRKLAAILALDLFLVGVDTTSVAASS 400
               :||..:|....|..|..|....:  .:||.:::.....:......:.|.....||||.|.|.
plant   246 ---VGKVREKRREMEKEGAEKPNTTLFSRLVEELIKGVITEEEVVDNMVLLVFAAHDTTSYAMSM 307

  Fly   401 TIYQLAKNPDKQKKLFDELQKVFPHREADINQNV--------LEQMPYLRACVKETLRMRPVVIA 457
            |...||::|..:..|..|      |.:...|:..        :::|.|....|:||:|:.|.:..
plant   308 TFKMLAQHPTCRDTLLQE------HAQIKANKGEGEYLTVEDVKKMKYSWQVVRETMRLSPPIFG 366

  Fly   458 NGRSLQSDAVINGYHVPKGTHVIFPHLVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHANQKIH 522
            :.|...:|....||.:|||..:::.......:|..|.:|..|.|.|:             ::.|.
plant   367 SFRKAVADIDYGGYTIPKGWKILWTTYGTHYNPEIFQDPMSFDPTRF-------------DKPIQ 418

  Fly   523 PFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKYKVSYNSGEFVYRVNSTYIPQSPLNF 582
            .:..||||.|.|:|.|.:.|:|.:     .:|..:.|:......||...:  |...||.|
plant   419 AYTYLPFGGGPRLCAGHQLAKISI-----LVFMHFVVTGFDWSLVYPDET--ISMDPLPF 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 109/495 (22%)
CYP718NP_181813.1 CYP90-like 78..482 CDD:410669 104/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.