DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and CYP712A1

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_181754.1 Gene:CYP712A1 / 818826 AraportID:AT2G42250 Length:514 Species:Arabidopsis thaliana


Alignment Length:498 Identity:124/498 - (24%)
Similarity:209/498 - (41%) Gaps:65/498 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SPAAAVRPYSEVPGPYPLPLIGNSWRFAPLIGTYKISDLDKVMNELHVNYGKMAKVGGLIGHPDL 156
            |.||...|.|    |..||.||:    ..|||  |:  |......|...||.:.::  .:|....
plant    35 SLAATKLPQS----PPALPFIGH----LHLIG--KV--LPVSFQSLAHKYGPLMEI--RLGASKC 85

  Fly   157 LFVFDGDEIRNIFKKEEA-MPHRPSMPSLRHYKGDLRRDFFGDVAGLIGVHGPKWEAFRQE-VQH 219
            :.|......|.|||::|. ...||...|..::|  .|...|     ::..:|..|...::. :..
plant    86 VVVSSSSVAREIFKEQELNFSSRPEFGSAEYFK--YRGSRF-----VLAQYGDYWRFMKKLCMTK 143

  Fly   220 ILLQPQTAKKYIPPLNDIASEFMGRIELMRDE----KDELPANFLHELYKWALESVGRVSLDTRL 280
            :|..||..|     ..||..|  .:::|:...    ::.||.:...:..|:....:.|:::.|| 
plant   144 LLAVPQLEK-----FADIREE--EKLKLVDSVAKCCREGLPCDLSSQFIKYTNNVICRMAMSTR- 200

  Fly   281 GCLSPEGSEEAQQIIEAINTFFWAVPELELRMPLWRIY-PTKAY------RSFVKALDQFTAICM 338
             |...:  .||::|.|.:....    ||..::.:..:. |.|..      :..|..::::. :.:
plant   201 -CSGTD--NEAEEIRELVKKSL----ELAGKISVGDVLGPLKVMDFSGNGKKLVAVMEKYD-LLV 257

  Fly   339 KNIGKTMDKADADEARGLSKSEADISIVERIVRKTGNRKLA----AILALDLFLVGVDTTSVAAS 399
            :.|.|..: |.|.:..|..|...|| ::|.....|...|:.    ....||:|:.|.||::.|..
plant   258 ERIMKERE-AKAKKKDGTRKDILDI-LLETYRDPTAEMKITRNDMKSFLLDVFMAGTDTSAAAMQ 320

  Fly   400 STIYQLAKNPDKQKKLFDELQKVFPHREADINQNVLEQMPYLRACVKETLRMRPVVIANGRSLQS 464
            ..:.||..:|....||.:|:..|...:.. :.::.:..:|||||.::||||:.|......|....
plant   321 WAMGQLINHPQAFNKLREEINNVVGSKRL-VKESDVPNLPYLRAVLRETLRLHPSAPLIIRECAE 384

  Fly   465 DAVINGYHVPKGTHVIFPHLVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHANQKIHPFVSLPF 529
            |..:||..|...|.|:.....:..|...:.:..||:|||:|:.|.:..|......|...|..|||
plant   385 DCQVNGCLVKSKTRVLVNVYAIMRDSELWADADRFIPERFLESSEEKIGEHQMQFKGQNFRYLPF 449

  Fly   530 GFGRRMCVGRRFAEIELHTLLAKIFRKY--------KVSYNSG 564
            |.|||.|.|...|...:|..:..:.:::        ||..:.|
plant   450 GSGRRGCPGASLAMNVMHIGVGSLVQRFDWKSVDGQKVDLSQG 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 119/486 (24%)
CYP712A1NP_181754.1 p450 9..508 CDD:299894 124/498 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.