DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and CYP710A4

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_180452.1 Gene:CYP710A4 / 817435 AraportID:AT2G28860 Length:493 Species:Arabidopsis thaliana


Alignment Length:488 Identity:112/488 - (22%)
Similarity:192/488 - (39%) Gaps:113/488 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VPGP-YPLPLIGNSWRFAPLIGTYKISDLDKVMNE----LHVNYGKMAKVGGLIGHPDLLFVFDG 162
            :||| :..|:|||.  .|.:.......|....|.:    |.|||        ||| ..::::.|.
plant    37 LPGPLFVFPIIGNV--VALIRDPTSFWDKQSAMADTSVGLSVNY--------LIG-KFIIYIKDA 90

  Fly   163 D----EIRNIFKKEEAMPHRPSMPSLR-HYKGDLRRDFFGDVAGLIGVHGPKWEAFRQEVQHILL 222
            :    .:.||         ||....|. |..|   :..||| ..||.:.|...::.|::|     
plant    91 ELSNKVLSNI---------RPDAFQLTGHPFG---KKLFGD-HSLIFMFGEDHKSVRRQV----- 137

  Fly   223 QPQTAKKYIPPLNDIASEFMGRIELMRDEKDELPANFLHELYKWALESVGRVSLDTRLGCLSPEG 287
            .|...:|   ||:..:|  :.:|.::|            .|.:|. ||....|....:..|..|.
plant   138 APNFTRK---PLSAYSS--LQQIVILR------------HLRQWE-ESFSSGSRPVSMRQLIREL 184

  Fly   288 SEEAQQIIEAINTFFWAVPELELRMPLWRIYP-----TKAY------------RSFVKALDQFTA 335
            :.|..|.:     |.....:.|::..:...|.     |.|.            |..|..|....:
plant   185 NLETSQTV-----FVGPYLDKEVKKTICDDYSLLTLGTMAIPIDLPGFTFGEARQAVSRLVNTMS 244

  Fly   336 ICMKNIGKTMDKADADEARGLSKSEADISIVER--IVRKTGNRKLAAILALDLFLVGVDTTSVAA 398
            :|   :||:..|..|.|...........||:|.  ....:.:::::.:| :|......|.::.:.
plant   245 VC---VGKSKAKMAAGENPTCLVDFWTHSIIEENPPPPHSKDKEISCVL-VDFMFASQDASTSSL 305

  Fly   399 SSTIYQLAKNPDKQKKLFDELQKVFPHREAD-INQNVLEQMPYLRACVKETLRMRP-------VV 455
            ...:..|...|:..:::.:::.:.:.....: |..:.|.:|.|.||..:|.||.||       |.
plant   306 LWAVVMLESEPEVLRRVREDVARFWSSESNELITADQLAEMKYTRAVAREVLRYRPPASMIPHVA 370

  Fly   456 IANGRSLQSDAVINGYHVPKGTHVIFPHLVVSNDPAY--FPEPKRFLPERWLKQSTDAAGCPHAN 518
            :::.|..:|      |.:|||| ::||.|.   |.::  |.||.||.|:|:.:...:        
plant   371 VSDFRLTES------YTIPKGT-IVFPSLF---DASFQGFTEPDRFDPDRFSETRQE-------- 417

  Fly   519 QKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLA 551
            .::.....|.||.|...|||:|:|...|...:|
plant   418 DEVFKRNFLTFGNGSHQCVGQRYAMNHLVLFIA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 112/487 (23%)
CYP710A4NP_180452.1 p450 38..459 CDD:299894 112/487 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574756at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.