DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and CYP94C1

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:432 Identity:92/432 - (21%)
Similarity:165/432 - (38%) Gaps:114/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 KGDLRRDFFGDV--AGLIGVHGPKWEAFRQEVQHILLQPQTAKKYIPPLNDIASEFMGRIELMRD 250
            ||.......||:  .|:....|..|...|:                     :||..:|.:.:   
plant    97 KGKQFSVILGDLLGRGIFNSDGDTWRFQRK---------------------LASLELGSVSV--- 137

  Fly   251 EKDELPANFLHELYKWALESVGRVSLDTRLGCLSPEGSEEAQQIIEAINTF----FWAVPELE-- 309
                  ..|.||:.|        ..::|||..:....|:....:::..:.|    |..:.:|.  
plant   138 ------RVFAHEIVK--------TEIETRLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFG 188

  Fly   310 -----LRMPLWRIYPTKAYRSFVKALDQFTAICMKN-------IGKTMDKADADEARGLSKSEAD 362
                 ||:|    :|..   .|..|.|..:.:..|.       :.||.........:.|.:|   
plant   189 FDPDCLRLP----FPIS---EFAVAFDTASLLSAKRALAPFPLLWKTKRLLRIGSEKKLQES--- 243

  Fly   363 ISIVERIV-------RKTG--------NRKLAAI----------LALDLFLVGVDTTSVAASSTI 402
            |:::.|:.       |.||        :|.:|.:          :.:...|.|.||.:...:...
plant   244 INVINRLAGDLIKQRRLTGLMGKNDLISRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFF 308

  Fly   403 YQLAKNPDKQKKLFDELQKV----FPHREADINQNVLEQMPYLRACVKETLRMRPVVIANGR-SL 462
            :.|.::|:.:.::.:||.:|    |....|..::  :.:|.||.|.:.|::|:.|.|..:.: :|
plant   309 WLLTRHPEVENRIREELDRVMGTGFDSVTARCDE--MREMDYLHASLYESMRLFPPVQFDSKFAL 371

  Fly   463 QSDAVINGYHVPKGTHVIFPHLVVSN-DPAYFPEPKRFLPERWLKQSTDAAGCPHANQKIHPF-- 524
            ..|.:.:|..|..||.|.:....:.. |..:.|:.:.|.|||||    |..|      |..|.  
plant   372 NDDVLSDGTFVNSGTRVTYHAYAMGRMDRIWGPDYEEFKPERWL----DNEG------KFRPENP 426

  Fly   525 VSLP-FGFGRRMCVGRRFAEIELHTLLAKIFRKYKVSYNSGE 565
            |..| |..|.|:|:|:..|.:|:.::...|.|:::....|.|
plant   427 VKYPVFQAGARVCIGKEMAIMEMKSIAVAIIRRFETRVASPE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 91/430 (21%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 92/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.