DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and npp-24

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001379685.1 Gene:npp-24 / 3564830 WormBaseID:WBGene00022672 Length:655 Species:Caenorhabditis elegans


Alignment Length:357 Identity:75/357 - (21%)
Similarity:132/357 - (36%) Gaps:96/357 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GGLIGHPDLLFVFDGD--EIRNIFKKEEAMPHRPSMP-----SLRHYKGDLRRDFFGDVAGLIGV 205
            ||::.|   |.||..:  |.|.:.|.:..:|.....|     .:|..|  :.|......:.|..|
 Worm   273 GGVLSH---LVVFPNEFGEFRFLVKDQLRLPSSNGDPRIVQNQIRSLK--VSRYEIATSSSLFSV 332

  Fly   206 H-GPKWEAFRQEVQHILLQPQTAKKYIPPLND--IASEFMGRI------------------ELMR 249
            : .|.:||.........|:.:|.   :..|.|  |.|:.:...                  .|..
 Worm   333 NIFPWFEALTSISPTSTLEKETR---VSELVDAVIPSDELSNTTKWTGARALRAVSVQLTQSLAT 394

  Fly   250 DEKDELP--ANFLH------------ELYK-------WALE---SVGR-----------VSLDTR 279
            :|::.||  .|.:|            .|:.       |:.|   |.||           .||:.:
 Worm   395 EEEELLPESENIMHLVILENKDGQPAHLFNISTFDNIWSTENKTSFGRDSVSQPPMKSTGSLEQQ 459

  Fly   280 LGCLSPEG----SEE--AQQIIEAINTFFWAVPE-LELRMPLWRIYPTK--AYRSFVKALDQFTA 335
            |..|.|..    ||:  .::.|:|...||.||.| |:....:.:::..:  |..|..:|||:.. 
 Worm   460 LAALKPLAACVISEKVSCEEAIDAAMKFFDAVDERLKKHCEISKLFVERCLAVSSSAQALDEKQ- 523

  Fly   336 ICMKNIGKTMDKADADEARGLSKSEADISIVERIVRKTGNRKLAAILALDLFLVGVDTTSVAASS 400
                   :::|:...:|..  :..|..|.:.|...|..|.||     .:::....|| .:|..|.
 Worm   524 -------QSVDQRLIEETN--TVEELKIRMHETKERMEGARK-----GINVLFHRVD-ENVPLSD 573

  Fly   401 TIYQLAKNPDKQKKLFDELQKVFPHREADINQ 432
            ...::.:...:.:|:..::.|:.|....|.|:
 Worm   574 NEIRIFERLKEHQKMLSDMTKLVPKMTLDSNE 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 75/357 (21%)
npp-24NP_001379685.1 Nup88 26..>212 CDD:401976
Smc <455..>653 CDD:224117 38/167 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.