DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and Cyp28d1

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster


Alignment Length:458 Identity:105/458 - (22%)
Similarity:173/458 - (37%) Gaps:96/458 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VFDGDEIRNIFKKEEAM-----PHRPSM----PSLRH--YKGDLRRDFFGDVAGLIG-------- 204
            |:|.|||...:|..:::     ...|.:    |...|  |..|.|.....::|....        
  Fly    57 VYDIDEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILA 121

  Fly   205 -----VHGPKWEAFRQEVQHILLQPQTAKKYIPPLNDIASEFMGRIELMRDEKDELPANFLH--E 262
                 :.|..|:..|.||...|...:....| |....:..:|   :|.:|.:....||..|:  :
  Fly   122 NNPFVLTGEAWKERRAEVTPGLSANRVKAAY-PVSLRVCKKF---VEYIRRQSLMAPAQGLNAKD 182

  Fly   263 LYKWALESVGRVSLDTRLGCLSPEGSEE-------AQQIIEAINTFFWAVPELELRMPLWRIYPT 320
            |   .|.....|..|..||..:...::.       .:::.|....|.:......|..|:.:.|..
  Fly   183 L---CLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLWPPITKFYSV 244

  Fly   321 KAYRSFVKALDQFTAICMKNIGKTMDKADA-------------DEARGLSKSEADISIVERIVRK 372
            ..:...|.|.  |..:..|.|....:...|             .|.:||:.:|.....:      
  Fly   245 SLFAKDVAAF--FYDLMQKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNAAELTSHTM------ 301

  Fly   373 TGNRKLAAILALDLFLV-GVDTTSVAASSTIYQLAKNPDKQKKLFDELQKVFPHREADINQNVLE 436
                         .||. |.:||:...:.|:..||:||.:|.||.:|:      ..|::....:.
  Fly   302 -------------TFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI------GTAELTFEQIS 347

  Fly   437 QMPYLRACVKETLRMRPVVIANGRSLQSDAVI---NGYHVP--KGTHVIFPHLVVSNDPAYFPEP 496
            ::|:..||:.||||:...|:|..:.:.....:   ||..|.  .|..||.|...:.:||.|:.||
  Fly   348 ELPFTEACIHETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEP 412

  Fly   497 KRFLPERWLKQSTDAAGCPHANQKIHPFVSLPFGF--GRRMCVGRRFAEIELHTLLAKIFRKYKV 559
            :.|.|||:|..:..|        |.:....|.|||  |.|:|.|.||:..::...|.:|.|.:.:
  Fly   413 QSFKPERFLNINGGA--------KKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDI 469

  Fly   560 SYN 562
            ..|
  Fly   470 KVN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 105/458 (23%)
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 105/458 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.