DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp49a1 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:456 Identity:105/456 - (23%)
Similarity:176/456 - (38%) Gaps:129/456 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VFDGDEIRNIFKKEEAMPHRPSMPSLRHYKGDLRRDFFGDVAGLIGVHGPKWEAFRQEVQHILLQ 223
            |:|.|.::.|..:.:...|. |...|..:.|          .||:.::|..|...|:     :|.
  Rat    99 VYDPDYMKLILGRSDPKSHH-SYRFLAPWIG----------YGLLLLNGQTWFQHRR-----MLT 147

  Fly   224 P----QTAKKYIPPLNDIASEFMGRIELMRDEKDELPAN------FLHELYKWALESVGRVSLDT 278
            |    .|.|.|:..:.|       .:.:|.|:.:::...      |.|         :..::|||
  Rat   148 PAFHYDTLKPYVGIMAD-------SVRIMLDKWEQIVGQDSTLEIFQH---------ITLMTLDT 196

  Fly   279 RLGC-LSPEGSEEAQQIIEAINTFFWAVPELELRMPLWRIYPTKAYRSFVKALDQFTAIC---MK 339
            .:.| .|.|||.:..                            :.|:|::||::....:.   ::
  Rat   197 IMKCAFSQEGSVQLD----------------------------RKYKSYIKAVEDLNNLSFFRIR 233

  Fly   340 NIGKTMD------------------------------KADADEARGLSKSE-------ADISIVE 367
            ||....|                              ||...:...|.|.:       .||.:..
  Rat   234 NIFHQNDIIYSLSSNGRKARSAWQLAHEHTDQVIKSRKAQLQDEEELQKVKQKRRLDFLDILLFA 298

  Fly   368 RIVR--KTGNRKLAAILALDLFLV-GVDTTSVAASSTIYQLAKNPDKQKKLFDELQKVFPHREAD 429
            ||..  ...::.|.|  .:|.|:. |.|||:...|...|.||.||:.|:....|:|.:... .|.
  Rat   299 RIENGSSLSDKDLRA--EVDTFMFEGHDTTASGISWIFYALATNPEHQQGCRKEIQSLLGD-GAS 360

  Fly   430 INQNVLEQMPYLRACVKETLRMRPVVIANGRSLQSDAVI-NGYHVPKGTHVIFPHLVVSNDPAYF 493
            |..:.|::|||...|:||.||:.|.|.|..|.|.:.... :|..:|||..|:.....:.::|..:
  Rat   361 ITWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTFPDGRSLPKGITVMLSFYGLHHNPTVW 425

  Fly   494 PEPKRFLPERWLKQSTDAAGCPHANQKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKYK 558
            |.|:.|.|.|:         .|.:::..|.|  |||..|.|.|:|::||..||...:|....:::
  Rat   426 PNPEVFDPYRF---------APESSRHSHSF--LPFSGGARNCIGKQFAMNELKVAVALTLLRFE 479

  Fly   559 V 559
            :
  Rat   480 L 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 105/456 (23%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 105/456 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.