DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and XLG2

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_195165.2 Gene:XLG2 / 829589 AraportID:AT4G34390 Length:861 Species:Arabidopsis thaliana


Alignment Length:297 Identity:75/297 - (25%)
Similarity:139/297 - (46%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNE 99
            ||||:|:.:.|.:||.||.:.::...|:.||.::.:.::.:|....|..:|.|......:.||::
plant   464 KLLLIGSEKGGATTIYKQARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQ 528

  Fly   100 R------ESDAKMVFDVCQRM-HDTE---------------PFSEELLAAMKRLWQDAGVQECFS 142
            .      |:.||....:..|: |.::               |.|.|....:..||:...:|..:.
plant   529 SSGNVGDETSAKPGNSINPRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQATYK 593

  Fly   143 RSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTT--GIVEVHFSF------------- 192
            |..: .|..:|.|||:.:..:...:|.|::.|||:....::  |:..|.|||             
plant   594 RLRD-TLPRNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPSTSQEESLESDY 657

  Fly   193 ---KNLNFKLFDVGGQRSERKKW--IHCFEDVTAIIFCVAMSEYDQVLHEDE--TTNRMQESLKL 250
               .::.::|..: ..||..:.|  :..|||...:||||::::|.:.:.:.|  ..|:|..:.:|
plant   658 QHDTDMKYQLIRL-NPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNIVNKMLATKQL 721

  Fly   251 FDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTIC 287
            |:::..:....:...:|.|.|.||.||||.:.||..|
plant   722 FENMVTHPSLANKRFLLVLTKFDLLEEKIEEVPLRTC 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 75/297 (25%)
XLG2NP_195165.2 G-alpha 464..840 CDD:206639 75/297 (25%)
G-alpha 464..837 CDD:278904 75/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.