DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and XLG1

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_565553.1 Gene:XLG1 / 816878 AraportID:AT2G23460 Length:888 Species:Arabidopsis thaliana


Alignment Length:403 Identity:110/403 - (27%)
Similarity:184/403 - (45%) Gaps:84/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHES-GFTAEDFK 67
            |.::.|:..:|.||.|..:|:...:|     |:||:|...||.|||.||.||:::. .|..::.:
plant   459 ANASGEQLYSANSRSILDHLEHRTLQ-----KILLVGNSGSGTSTIFKQAKILYKDVPFLEDERE 518

  Fly    68 QYRPVVYSNTIQSLVAILRAMPTL---SIQYSNNER---------ESDAK------MVFDVCQRM 114
            ..:.::.:|....|..:|......   ::...|.::         |.|||      .::.:..|:
plant   519 NIKVIIQTNVYGYLGMLLEGRERFEEEALALRNTKQCVLENIPADEGDAKSNDKTVTMYSIGPRL 583

  Fly   115 HDTEPFSEELLAAM--------------------KRLWQDAGVQECFSRSNEYQLNDS-AKYFLD 158
               :.||:.||..|                    :.||:||.:|..:.|.:|..|..| |.|||:
plant   584 ---KAFSDWLLKTMAAGNLGVIFPAASREYAPLVEELWRDAAIQATYKRRSELGLLPSVASYFLE 645

  Fly   159 DLDRLGAKDYQPTEQDILRTR--VKTTGIVEVHFSFKN----------------LNFKLFDVGGQ 205
            ....:...||:|::.|||...  ..::|:..:.|||..                |.::|..|..:
plant   646 RAIDVLTPDYEPSDLDILYAEGVTSSSGLACLDFSFPQTASEENLDPSDHHDSLLRYQLIRVPSR 710

  Fly   206 -RSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFL 269
             ..|..|||..||||..::|.|:||:||||  .::.||:|..:.|||:||..:..|.:...:|.|
plant   711 GLGENCKWIDMFEDVGMVVFVVSMSDYDQV--SEDGTNKMLLTKKLFESIITHPIFENMDFLLIL 773

  Fly   270 NKKDLFEEKIRKSPLTIC--FPEY-----------TGGQEYGEAAAYIQA-QFEAKNKS-TSKEI 319
            ||.||.|||:.:.||..|  |.::           .|....|:.|.:..| :|:....| |.|::
plant   774 NKYDLLEEKVERVPLARCEWFQDFNPVVSRHRGSNNGNPTLGQLAFHFMAVKFKRFYSSLTGKKL 838

  Fly   320 YCHMTCATDTNNI 332
            :...:.:.|.|::
plant   839 FVSSSKSLDPNSV 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 102/373 (27%)
XLG1NP_565553.1 G-alpha 484..864 CDD:206639 103/378 (27%)
G-alpha 485..862 CDD:278904 102/372 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.