DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and Gnaq

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_112298.2 Gene:Gnaq / 81666 RGDID:620770 Length:359 Species:Rattus norvegicus


Alignment Length:353 Identity:178/353 - (50%)
Similarity:233/353 - (66%) Gaps:9/353 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAED 65
            |.|..|.|.:.|...:..|||.|:.|...|.:::||||||.|||||||.:|||:|||.||::.||
  Rat     7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 71

  Fly    66 FKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTE---PFSEELLAA 127
            .:.:..:||.|...::.|::|||.||.|.|.....::.|::|.:|     |.|   .|....:.|
  Rat    72 KRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREV-----DVEKVSAFENPYVDA 131

  Fly   128 MKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSF 192
            :|.||.|.|:|||:.|..||||:||.||:|:||||:....|.||:||:||.||.||||:|..|..
  Rat   132 IKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL 196

  Fly   193 KNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNN 257
            :::.|::.|||||||||:|||||||:||:|:|.||:|||||||.|.:..|||:||..||.:|...
  Rat   197 QSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITY 261

  Fly   258 KWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAA-AYIQAQFEAKNKSTSKEIYC 321
            .||.::|:|||||||||.||||..|.|...||||.|.|...:|| .:|...|...|..:.|.||.
  Rat   262 PWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYS 326

  Fly   322 HMTCATDTNNIQFVFDAVTDVIIANNLR 349
            |.||||||.||:|||.||.|.|:..||:
  Rat   327 HFTCATDTENIRFVFAAVKDTILQLNLK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 165/317 (52%)
GnaqNP_112298.2 G-alpha 40..353 CDD:206639 165/317 (52%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 41..54 11/12 (92%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 178..186 5/7 (71%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 201..210 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 270..277 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 329..334 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.