DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gnaz

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_005155690.2 Gene:gnaz / 564915 ZFINID:ZDB-GENE-090420-3 Length:355 Species:Danio rerio


Alignment Length:355 Identity:217/355 - (61%)
Similarity:259/355 - (72%) Gaps:3/355 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAED 65
            |||.||.||:.||.|||.|:|:|:.:..:..::|||||||...||||||||||||||..||..|.
Zfish     1 MGCRQSTEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEA 65

  Fly    66 FKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKR 130
            .|:|:|::..|.|.||..|:||:.||.|.:.|.:|..||..:|.:..........:.|||..|||
Zfish    66 CKEYKPLILYNAIDSLTRIIRALATLKIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMKR 130

  Fly   131 LWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNL 195
            ||.|.||||||.|||||.|.|:..|:|:||||:.|.:|.||.:||||:|..||||||..|:||.|
Zfish   131 LWADPGVQECFCRSNEYHLEDNTAYYLNDLDRISAPEYIPTVEDILRSRDMTTGIVENKFTFKEL 195

  Fly   196 NFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWF 260
            .||:.|||||||||||||||||.||||||||.:|.||..|:||..|:||.|||:||||||||.||
Zfish   196 TFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWF 260

  Fly   261 TDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFE--AKNKSTSKEIYCHM 323
            |:||:|||||||||..|||::.|||:||.:|.|...|.|||.|:|.|||  .:||.| ||||.|.
Zfish   261 TNTSLILFLNKKDLLAEKIKRIPLTVCFADYKGQNTYEEAAVYVQRQFEDLNRNKET-KEIYSHF 324

  Fly   324 TCATDTNNIQFVFDAVTDVIIANNLRGCGL 353
            ||||||:||||||||||||||.|||:..||
Zfish   325 TCATDTSNIQFVFDAVTDVIIQNNLKYIGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 198/315 (63%)
gnazXP_005155690.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D406662at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.