DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gna14a

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_683989.2 Gene:gna14a / 556160 ZFINID:ZDB-GENE-081105-76 Length:354 Species:Danio rerio


Alignment Length:349 Identity:170/349 - (48%)
Similarity:238/349 - (68%) Gaps:3/349 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDF 66
            ||..||||:.....::.|::.|::|...:.:::||||||.|||||||.:|||:|||.||:|.:|.
Zfish     3 GCCMSAEEKERQRINQEIDKQLRKDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDDDK 67

  Fly    67 KQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRL 131
            |.:..:|:.||:.::.:::|||..|.|.|:|:|.::.:.:|.|:  .:.......|..:.|:..|
Zfish    68 KGFIKLVHQNTLSAMQSMVRAMDMLKIAYANSENQAHSALVNDI--EVDKIMSLDETQVKALSSL 130

  Fly   132 WQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLN 196
            |.|:|:|||:.|..||||.|||||:|.||||:....|.||||||||.||.||||:|..|...|:.
Zfish   131 WSDSGIQECYDRRREYQLTDSAKYYLSDLDRIANAAYVPTEQDILRVRVPTTGIIEYPFDLDNVI 195

  Fly   197 FKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFT 261
            |::.|||||||||:|||||||:||:|||.||:|||||||.|.:..|||:||..||.:|....||.
Zfish   196 FRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFQ 260

  Fly   262 DTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAA-AYIQAQFEAKNKSTSKEIYCHMTC 325
            .:|:||||||.|:.:|||..|.:...|||:||.:...:|| .:|...::.:|:...|.||.|.||
Zfish   261 SSSVILFLNKTDILKEKIVYSHVATYFPEFTGPKNDPKAAQEFILKMYQEENEDKDKTIYSHFTC 325

  Fly   326 ATDTNNIQFVFDAVTDVIIANNLR 349
            ||||.||:.:|.||.|.|:.:||:
Zfish   326 ATDTENIRLIFAAVKDTILRHNLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 159/314 (51%)
gna14aXP_683989.2 G_alpha 15..352 CDD:214595 164/337 (49%)
G-alpha 35..348 CDD:206639 159/314 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.