DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gna12a

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001013295.1 Gene:gna12a / 503589 ZFINID:ZDB-GENE-050221-1 Length:385 Species:Danio rerio


Alignment Length:346 Identity:154/346 - (44%)
Similarity:217/346 - (62%) Gaps:7/346 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVV 73
            ||.|..|||.|:..||.:.....:.:|:||||||||||||.:|||:|||...|..:....:|..:
Zfish    37 EREAKRRSREIDSMLKRERRSIRRLVKILLLGAGESGKSTFLKQMRIIHGKEFDQKALLDFRDTI 101

  Fly    74 YSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRM-HDTEPFSEEL-LAAMKRLWQDAG 136
            :.|.|:.:..::.|...|.|.:.|:|.|.....|.....:. ...||.:.:| :.|::.||.|:|
Zfish   102 FENVIKGMRVLVDARDKLGISWQNSENEKHGMFVMSFENKAGMAVEPCTFQLYVPALQALWNDSG 166

  Fly   137 VQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFD 201
            :||.:.|.:|:||::|.|||||:|||:|...|.|:.||||..|..|.||||..|..|.:.||:.|
Zfish   167 IQEAYGRRSEFQLSESVKYFLDNLDRIGQLSYVPSRQDILLARKATKGIVEHDFVIKKIPFKMVD 231

  Fly   202 VGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSII 266
            ||||||:|:||..||:.:|:|:|.|:.|||||||.||..|||:.||:.:|::|.|||.|::.|||
Zfish   232 VGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFSNVSII 296

  Fly   267 LFLNKKDLFEEKIRKSPLTIC--FPEYTGG-QEYGEAAAYIQAQFEAKNKSTSKEIYCHMTCATD 328
            |||||.||..||:||  ::||  |.::.|. ....:..||:...|..|.::..|.::.|.|.|.|
Zfish   297 LFLNKMDLLVEKVRK--VSICKHFSDFRGDPHRLVDVQAYLVQCFNRKRRNRIKPLFHHFTTAID 359

  Fly   329 TNNIQFVFDAVTDVIIANNLR 349
            |.||:|||.||.|.|:..||:
Zfish   360 TENIRFVFHAVKDTILQENLK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 143/318 (45%)
gna12aNP_001013295.1 G_alpha 41..383 CDD:214595 151/342 (44%)
G-alpha 62..379 CDD:206639 143/318 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.