DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gna15.1

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001003626.2 Gene:gna15.1 / 445232 ZFINID:ZDB-GENE-040801-146 Length:367 Species:Danio rerio


Alignment Length:356 Identity:162/356 - (45%)
Similarity:226/356 - (63%) Gaps:7/356 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFK 67
            |..|.|::.|......|:|.|.|...:..::||:||||.|||||:|.:|||:|||..||:.||.:
Zfish    13 CCLSEEDKNAIVIHNEIKRILAEQKKRERREIKVLLLGTGESGKTTFIKQMRIIHGKGFSEEDRR 77

  Fly    68 QYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLW 132
            .|...||.|...::.|:..||.:|.|.|:|.:.|:..:...||  .:..........:.|::|||
Zfish    78 GYIKNVYQNIFTAMRAMTGAMESLRIPYANPQNEAYGRQFKDV--EIRQVTQLDRMYVEAIRRLW 140

  Fly   133 QDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNF 197
            .|.|::.|:.|..||||.||.:|::.:|||:.|.||.||.||:||.|..||||.:..||.:.:..
Zfish   141 ADPGIKACYCRRREYQLLDSTEYYMTNLDRIAAPDYIPTAQDVLRVRFPTTGINDYSFSVEKITL 205

  Fly   198 KLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTD 262
            ::.|||||:|||:|||||||:||::||..::|||||||.|:...|||:|||.||.:..::.||..
Zfish   206 RIVDVGGQKSERRKWIHCFENVTSLIFLASLSEYDQVLEENSKENRMKESLSLFYTTIHSPWFAS 270

  Fly   263 TSIILFLNKKDLFEEKIRKSPLTICFPEYTG-GQEYGEAAAYIQAQFEAKNK----STSKEIYCH 322
            .||||||||.|:.||||:.|.|...|||:.| .::..:|.:||...:|.|.|    .|||:||.|
Zfish   271 ASIILFLNKMDILEEKIQSSDLKAYFPEFQGRRRDVQDAKSYISHLYEQKAKCTETKTSKQIYPH 335

  Fly   323 MTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353
            .|||||||||:.||..|.|.::..:||..|:
Zfish   336 FTCATDTNNIRKVFGDVKDTVLIRSLREYGV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 151/318 (47%)
gna15.1NP_001003626.2 G-alpha 44..361 CDD:206639 151/318 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.