DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and CG17760

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster


Alignment Length:356 Identity:161/356 - (45%)
Similarity:223/356 - (62%) Gaps:17/356 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCA---QSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFT 62
            |.|.   |:.|||..   ||.|::.||.:..:|.:::|||:||.|||||:|.:|||:|||..||.
  Fly     1 MDCCLSDQACEERRI---SREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFL 62

  Fly    63 AEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMV----FDVCQRMHDTEPFSEE 123
            .::.||:...|:.|...::.:::.||.||.|.|...|....|.:|    :....|:.  .|:   
  Fly    63 DKERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLE--APY--- 122

  Fly   124 LLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEV 188
             |.|:|.||:|||::||::|..||||.||.:|||:|:.|:...|||.|:||||..|..||.|||.
  Fly   123 -LNAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEY 186

  Fly   189 HFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDS 253
            .|:......:|.||.|||:||:||||||.:||:|:|.|||||:|..|.|.|..|||:||..||.:
  Fly   187 PFNLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHN 251

  Fly   254 ICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAA-AYIQAQFEAKNKSTSK 317
            |.:..||..:|:||||||:|||::||..:.|...||||.|.::..:|| .:|...|.:.|....|
  Fly   252 IISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYK 316

  Fly   318 EIYCHMTCATDTNNIQFVFDAVTDVIIANNL 348
            .||.|.|.||:|.||:|||.||.|.|:..:|
  Fly   317 CIYPHFTVATNTENIKFVFTAVKDTILELHL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 148/318 (47%)
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 156/344 (45%)
G-alpha 34..347 CDD:206639 148/318 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455788
Domainoid 1 1.000 229 1.000 Domainoid score I660
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I1124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 1 1.000 - - otm3584
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
109.900

Return to query results.
Submit another query.