DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gna13b

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001013281.2 Gene:gna13b / 336333 ZFINID:ZDB-GENE-030131-8277 Length:377 Species:Danio rerio


Alignment Length:356 Identity:155/356 - (43%)
Similarity:220/356 - (61%) Gaps:10/356 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFK 67
            |...:.:.....:|:.|:|.:.::.....:.:|:||||||||||||.:|||:|||...|...|.:
Zfish    18 CFLDSSDAEQLRKSKEIDREIFKEKTFVKRLVKILLLGAGESGKSTFLKQMRIIHGDDFDKGDKE 82

  Fly    68 QYRPVVYSNTIQSLVAILRAMPTLSIQYSN--NERESDAKMVFD-----VCQRMHDTEPFSEELL 125
            ::|..:|||.::.:..::.|...|.|.:.|  |:..:|..|.||     |.|.|.:|:.| .:.|
Zfish    83 EFRGTIYSNVMKGVRVLVDAREKLHIPWGNPSNQTHADIMMAFDTRSTMVSQGMLETKLF-PQYL 146

  Fly   126 AAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHF 190
            .:::.||.|.|:|..:.|..|:||.:|.|||||:||:|||.||.||:||||..|..|.||.|..|
Zfish   147 PSIRALWADIGIQHAYDRRREFQLGESVKYFLDNLDKLGAPDYLPTQQDILLARKPTKGIHEYDF 211

  Fly   191 SFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSIC 255
            ..||:.||:.|||||||||::|..|||.||:|:|.|:.|||||||.||..|||:.|||.:|::|.
Zfish   212 EIKNVPFKMVDVGGQRSERRRWFECFESVTSILFLVSSSEYDQVLMEDRQTNRLMESLNIFETIV 276

  Fly   256 NNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQE-YGEAAAYIQAQFEAKNK-STSKE 318
            ||:.|.:.||||||||.||.|||::...:...|||:|.... .|:...::...|..|.: ...|.
Zfish   277 NNRVFNNVSIILFLNKTDLLEEKVKSVSIQDYFPEFTDDPWCLGDVKNFLVECFRNKRRDQQQKP 341

  Fly   319 IYCHMTCATDTNNIQFVFDAVTDVIIANNLR 349
            :|.|.|.|.:|.||:.||..|.|.|:.:||:
Zfish   342 LYHHFTTAINTENIRLVFRDVKDTILHDNLK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 149/322 (46%)
gna13bNP_001013281.2 G_alpha 29..375 CDD:214595 154/345 (45%)
G-alpha 49..371 CDD:206639 149/322 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.