DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and GNAS

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_016883301.1 Gene:GNAS / 2778 HGNCID:4392 Length:1038 Species:Homo sapiens


Alignment Length:382 Identity:164/382 - (42%)
Similarity:220/382 - (57%) Gaps:44/382 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRP 71
            |::||...||:||::.|:::.:......:||||||||||||||||||:|:|.:||..|..::...
Human   657 AQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQ 721

  Fly    72 VVYSNT-------------------IQSLVAILRAMPTL--SIQYSNNERESDAKMVFDVCQRMH 115
            ...||:                   |:::||   ||..|  .::.:|.|.:.....:..| ..:.
Human   722 AARSNSDGSEKATKVQDIKNNLKEAIETIVA---AMSNLVPPVELANPENQFRVDYILSV-MNVP 782

  Fly   116 DTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRV 180
            |.: |..|.....|.||:|.||:.|:.|||||||.|.|:||||.:|.:...||.|::||:||.||
Human   783 DFD-FPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRV 846

  Fly   181 KTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQ 245
            .|:||.|..|....:||.:|||||||.||:|||.||.|||||||.||.|.|:.|:.||..|||:|
Human   847 LTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQ 911

  Fly   246 ESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKI--RKSPLTICFPE---YTGGQ----EYGE-- 299
            |:|.||.||.||:|....|:||||||:||..||:  .||.:...|||   ||..:    |.||  
Human   912 EALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDP 976

  Fly   300 ----AAAYIQAQF-EAKNKSTSKEIYC--HMTCATDTNNIQFVFDAVTDVIIANNLR 349
                |..:|:.:| .....|.....||  |.|||.||.||:.||:...|:|...:||
Human   977 RVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLR 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 154/352 (44%)
GNASXP_016883301.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.