DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and GNAI1

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_002060.4 Gene:GNAI1 / 2770 HGNCID:4384 Length:354 Species:Homo sapiens


Alignment Length:356 Identity:247/356 - (69%)
Similarity:295/356 - (82%) Gaps:4/356 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAED 65
            |||..|||::||..||::|:|||:|||.:||:::||||||||||||||||||||||||:|::.|:
Human     1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEE 65

  Fly    66 FKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPF-SEELLAAMK 129
            .|||:.|||||||||::||:|||..|.|.:.::.|..||:.:|.:.....  |.| :.||...:|
Human    66 CKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAE--EGFMTAELAGVIK 128

  Fly   130 RLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKN 194
            |||:|:|||.||:||.||||||||.|:|:||||:...:|.||:||:||||||||||||.||:||:
Human   129 RLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKD 193

  Fly   195 LNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKW 259
            |:||:||||||||||||||||||.|||||||||:|:||.||.|||..|||.||:|||||||||||
Human   194 LHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKW 258

  Fly   260 FTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNK-STSKEIYCHM 323
            ||||||||||||||||||||:|||||||:|||.|...|.|||||||.|||..|| ..:||||.|.
Human   259 FTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHF 323

  Fly   324 TCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354
            ||||||.|:||||||||||||.|||:.|||:
Human   324 TCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 223/315 (71%)
GNAI1NP_002060.4 G-alpha 34..348 CDD:206639 223/315 (71%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 12/12 (100%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 173..181 6/7 (86%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 196..205 7/8 (88%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 265..272 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D406662at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100285
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R506
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.