DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gpa-18

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001293719.1 Gene:gpa-18 / 189161 WormBaseID:WBGene00020997 Length:320 Species:Caenorhabditis elegans


Alignment Length:321 Identity:70/321 - (21%)
Similarity:123/321 - (38%) Gaps:62/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQ-SLVAILR----AMPTLSI 93
            |:.|:||...:||::.::||...|.....      .|..:|...:| :|:.|.|    .:..|.|
 Worm    12 IRTLVLGCMGAGKTSFIRQMVKNHTKSIC------LRRELYLYCVQLNLLNIYRELKNVIEALEI 70

  Fly    94 QYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLD 158
            ..|     .|.|..|.........|.|..:::.|||.|::....:.|..|.....|..:..:...
 Worm    71 PIS-----EDQKQRFTQLDEYRHREVFPPKIIEAMKELFESGLYELCRLRQRILPLPQNYHFLFQ 130

  Fly   159 DLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAII 223
            ..|.....:|.|:|.:|:.:..:|.|:...:.:.:...|:|.::.|....|.||...|:|...::
 Worm   131 RGDDFMNPEYVPSELEIMMSYSQTCGLNRENVTCQGYKFELLEMPGHHLWRAKWADYFDDPNLVV 195

  Fly   224 FCVAMSE------YDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEE----- 277
            |.:.:||      |::...|::|       :.:|:|:.||........:|..||.|.|.:     
 Worm   196 FVIDLSELCDPAFYNKGYLENKT-------VTVFESLVNNPVLAKVYWLLLFNKADTFNDHSAGF 253

  Fly   278 -------------------------KIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNK 313
                                     ||.|   |.|||.......:.|:.:.:...|:...|
 Worm   254 DFRKLANHLDTADSARSFYRSQFTTKISK---TRCFPHIVSLVNFKESQSVMMEMFKKIGK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 70/321 (22%)
gpa-18NP_001293719.1 G-alpha 12..309 CDD:278904 69/317 (22%)
P-loop_NTPase 12..289 CDD:304359 67/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.