DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment Galphao and slc66a1

Sequence 1:	NP_523684.2	Gene:	Galphao / 36104	FlyBaseID:	FBgn0001122	Length:	354	Species:	Drosophila melanogaster
Sequence 2:	XP_004916475.2	Gene:	slc66a1 / 101731365	XenbaseID:	XB-GENE-996169	Length:	303	Species:	Xenopus tropicalis

Alignment Length:	33	Identity:	11/33 - (33%)
Similarity:	12/33 - (36%)	Gaps:	14/33 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly   295 QEYGEAA--------------AYIQAQFEAKNK 313
            ||.|.||              ||.:..|..|||
Frog   155 QEAGPAALSSEDVFHGRRLLSAYGEEGFSVKNK 187

Gene	Sequence	Domain	Region	External ID	Identity
Galphao	NP_523684.2	G-alpha	34..348	CDD:206639	11/33 (33%)
slc66a1	XP_004916475.2	PQ-loop	40..101	CDD:461220
slc66a1	XP_004916475.2	PQ-loop	188..243	CDD:461220	11/33 (33%)
Blue background indicates that the domain is not in the aligned region.