DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gna15

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002934852.2 Gene:gna15 / 100496529 XenbaseID:XB-GENE-1011753 Length:373 Species:Xenopus tropicalis


Alignment Length:369 Identity:159/369 - (43%)
Similarity:219/369 - (59%) Gaps:32/369 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYR 70
            |.||..|...:|.|||.||....::..:||:||||.|||||||.:|||:|||.:||:.::.|.|.
 Frog    15 SEEETTALTVNREIERILKLQKERSRGEIKVLLLGTGESGKSTFIKQMRIIHGAGFSEQERKFYA 79

  Fly    71 PVVYSNTIQSLVAILRAMPTLSIQYS--NNE------RESDAKMVFDVCQRMHDTEPFSEELLAA 127
            .:|:.|.:....:::.||.||.:.||  ||:      .|.||..:          :...|..:.|
 Frog    80 RLVHQNIVTCAQSLVGAMETLQVPYSIENNQINGRKISELDAFRI----------QAIEEPYVKA 134

  Fly   128 MKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSF 192
            :|.||.|.|:|.|:.|..|:||.||..|:|.:|:||....||||::||||.|:.||||.|..|..
 Frog   135 IKNLWSDTGIQRCYERRREFQLLDSTNYYLSNLERLTQDMYQPTDEDILRIRMPTTGINEYSFPV 199

  Fly   193 KNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNN 257
            :|:|.::.|||||:|||:||||.||:|:|:|:..::|||||.|.|:...|||:|||.||.:|...
 Frog   200 ENMNLRMVDVGGQKSERRKWIHSFENVSALIYLASLSEYDQRLEENCHDNRMKESLALFRNILEL 264

  Fly   258 KWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAY------------IQAQFEA 310
            .||.:|.|||||||.||.||||..|.|...|..:.|.....|||..            |:.| :|
 Frog   265 PWFQETPIILFLNKTDLLEEKIAFSDLANYFHRFKGPCRDAEAAKQFILDNYKEIFNKIRKQ-DA 328

  Fly   311 KNKSTSK-EIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGL 353
            ..|...| ::|.|.||||||:||:.||:.|.:.::...|...|:
 Frog   329 SGKDDLKHKVYHHFTCATDTDNIRKVFNNVKEAVLVKYLMDFGI 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 147/334 (44%)
gna15XP_002934852.2 G-alpha 43..363 CDD:206639 147/330 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.