DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphao and gna13

DIOPT Version :9

Sequence 1:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001120411.1 Gene:gna13 / 100145489 XenbaseID:XB-GENE-6257775 Length:377 Species:Xenopus tropicalis


Alignment Length:356 Identity:153/356 - (42%)
Similarity:218/356 - (61%) Gaps:10/356 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFK 67
            |..::.|.....:|:.|:|.|..:.....:.:|:||||||||||||.:|||:|||...|.....:
 Frog    18 CVLTSREAEQQRKSKEIDRCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDLRAKE 82

  Fly    68 QYRPVVYSNTIQSLVAILRAMPTLSIQYSN--NERESDAKMVFD-----VCQRMHDTEPFSEELL 125
            ::|..:|||.|:.:..::.|...|.|.:.:  |::..:..|.||     |.|.|.:|:.|...||
 Frog    83 EFRATIYSNVIKGIRVLVDAREKLHIPWGDPANQKHGEVMMAFDTRSAMVAQGMVETQVFVSHLL 147

  Fly   126 AAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHF 190
             :::.||.|.|:|..:.|..|:||.:|.|||||:||:||.|||.|::||||..|..|.||.|..|
 Frog   148 -SIRSLWADTGIQTAYDRRREFQLGESVKYFLDNLDKLGDKDYLPSQQDILLARRPTKGIHEYDF 211

  Fly   191 SFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSIC 255
            ..||:.||:.||||||||||:|..||:.||:|:|.|:.|||||||.||..|||:.|||.:|::|.
 Frog   212 EIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEYDQVLMEDRQTNRLTESLNIFETIV 276

  Fly   256 NNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQE-YGEAAAYIQAQFEAKNK-STSKE 318
            ||:.|::.||||||||.||.|||:|...:...|.::.|... ..:...::...|..|.: ...|.
 Frog   277 NNRVFSNVSIILFLNKTDLLEEKVRIVSIKDYFADFEGDPHCLEDVQKFLVNCFRNKRRDQQQKP 341

  Fly   319 IYCHMTCATDTNNIQFVFDAVTDVIIANNLR 349
            :|.|.|.|.:|.||:.||..|.|.|:.:||:
 Frog   342 LYHHFTTAINTENIRLVFRDVKDTILHDNLK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 145/322 (45%)
gna13NP_001120411.1 G_alpha 29..375 CDD:214595 151/345 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.