DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and Sdhaf2

DIOPT Version :10

Sequence 1:NP_610586.3 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_079609.2 Gene:Sdhaf2 / 66072 MGIID:1913322 Length:164 Species:Mus musculus


Alignment Length:113 Identity:60/113 - (53%)
Similarity:79/113 - (69%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DPPHLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLIN 108
            |...:|:|.:..|.||.:||::.||||:|||||||||.:|||.|..::|.:...:|...||:|||
Mouse    44 DMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLIN 108

  Fly   109 GVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRIRQPDL 156
            ..||||||:||||:.||.|..|:.|:|.||:|..||..|.||:|.|||
Mouse   109 EPSNDWDIYYWATEAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_610586.3 Sdh5 67..142 CDD:461097 43/74 (58%)
Sdhaf2NP_079609.2 Sdh5 66..142 CDD:461097 43/75 (57%)

Return to query results.
Submit another query.