DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and Sdhaf2

DIOPT Version :9

Sequence 1:NP_001260868.1 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_079609.2 Gene:Sdhaf2 / 66072 MGIID:1913322 Length:164 Species:Mus musculus


Alignment Length:113 Identity:60/113 - (53%)
Similarity:79/113 - (69%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DPPHLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLIN 108
            |...:|:|.:..|.||.:||::.||||:|||||||||.:|||.|..::|.:...:|...||:|||
Mouse    44 DMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLIN 108

  Fly   109 GVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRIRQPDL 156
            ..||||||:||||:.||.|..|:.|:|.||:|..||..|.||:|.|||
Mouse   109 EPSNDWDIYYWATEAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_001260868.1 Sdh5 65..138 CDD:281870 40/72 (56%)
Sdhaf2NP_079609.2 Sdh5 65..138 CDD:281870 40/72 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833062
Domainoid 1 1.000 96 1.000 Domainoid score I7304
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 131 1.000 Inparanoid score I4606
Isobase 1 0.950 - 0 Normalized mean entropy S1158
OMA 1 1.010 - - QHG48810
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm42899
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - O PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.