DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and sdhaf2

DIOPT Version :9

Sequence 1:NP_001260868.1 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001076333.1 Gene:sdhaf2 / 569482 ZFINID:ZDB-GENE-030131-7564 Length:158 Species:Danio rerio


Alignment Length:118 Identity:57/118 - (48%)
Similarity:80/118 - (67%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DYDDPP--HLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEY 103
            |..:|.  .:|:|.:..|..|.|:.:::||||:|||||||||.:|||.|..::|...:..|..:|
Zfish    34 DAPEPTILEIPLPPWQERAGEALDIKRKRLLYESRKRGMLENCILLSLFAKQYLNTMSESQLKQY 98

  Fly   104 DQLINGVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRIRQPDL 156
            |:|||..||||||:||||||:|||..:..|:|.:|||..||.:..||:..|:|
Zfish    99 DRLINEPSNDWDIYYWATDTQPTPEVYQGEVMDMLKEFTKNRDMEQRLDAPNL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_001260868.1 Sdh5 65..138 CDD:281870 41/72 (57%)
sdhaf2NP_001076333.1 Sdh5 60..133 CDD:281870 41/72 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575781
Domainoid 1 1.000 97 1.000 Domainoid score I7199
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 126 1.000 Inparanoid score I4670
OMA 1 1.010 - - QHG48810
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm24586
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - O PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.