DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12895 and Sdhaf2

DIOPT Version :9

Sequence 1:NP_001260868.1 Gene:CG12895 / 36103 FlyBaseID:FBgn0033523 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001008372.1 Gene:Sdhaf2 / 361726 RGDID:1309216 Length:164 Species:Rattus norvegicus


Alignment Length:151 Identity:65/151 - (43%)
Similarity:90/151 - (59%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVSTVGRRLQLPMMAQSRLASNLDKTEYTTPGEIVDYDDPPHLPVPEYPVRPDEPLETRKQRLLY 70
            ::.|:.|.|....:....|:....:..|..........|...:|:|.:..|.||.:||::.||||
  Rat     6 LIPTLARVLSKHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLY 70

  Fly    71 QSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFYWATDTKPTPPQFDTEIM 135
            :|||||||||.:|||.|..::|.:...:|...||:|||..||||||:||||:.||.|..|:.|:|
  Rat    71 ESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVM 135

  Fly   136 RLLKEHVKNHEKVQRIRQPDL 156
            .||:|..||..|.||:|.|||
  Rat   136 ELLREFTKNKNKEQRLRAPDL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12895NP_001260868.1 Sdh5 65..138 CDD:281870 40/72 (56%)
Sdhaf2NP_001008372.1 Sdh5 65..138 CDD:397843 40/72 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336642
Domainoid 1 1.000 96 1.000 Domainoid score I7140
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 131 1.000 Inparanoid score I4534
OMA 1 1.010 - - QHG48810
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm44966
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - O PTHR12469
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.